PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.N03139.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family BBR-BPC
Protein Properties Length: 348aa    MW: 39017.1 Da    PI: 10.338
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.N03139.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind332.98.8e-102632319294
         GAGA_bind  19 slkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvensla......salpvgvqvlsgt 105
                       s+k     q+m  +aerda+i+ernla+sekk a+aerdma lqrd+a+aern+a++erdn++++l+++en+++      s +p+g+q+ +g+
  Migut.N03139.2.p   6 SMK-----QIMGFMAERDAAIQERNLAISEKKTALAERDMAILQRDSAIAERNNAIMERDNAIATLQYRENAINssnnnmSPCPPGCQIPRGV 93 
                       444.....9**************************************************************998888988899********** PP

         GAGA_bind 106 ksidslqqlse............pqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesader 186
                       k++++ qq+++            +++++s+++ ++++ +++++++++            + + ++p ++ a +++k++++++ k++k+ a   
  Migut.N03139.2.p  94 KHMHHPQQHQQqqqqhihhhhhqSHMAESPYNNNNNSSNNNNNTRDNM-----------QMSDTVPISPVAPEPTKTRRAKRAKEAKPAATAA 175
                       *****9995552333444444443333333333322222222222222...........2233344444444444444444333333333211 PP

         GAGA_bind 187 ........................................skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCttti 239
                                                                k ++k++dl+ln+v++Dest+PvPvCsCtG lr CYkWGnGGWqS+CCtt++
  Migut.N03139.2.p 176 prkasknskrvkreednnlndlnnlnkavfgkshdmelggPKLDWKDQDLGLNQVAFDESTMPVPVCSCTGFLRPCYKWGNGGWQSSCCTTNL 268
                       234555555666666778899************************************************************************ PP

         GAGA_bind 240 SvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGt 294
                       S+yPLP+++++r+aR++grKmS++af+kl+++LaaeG+dlsnpvDLkdhWAkHGt
  Migut.N03139.2.p 269 SMYPLPAVPNKRHARVGGRKMSGSAFNKLISRLAAEGHDLSNPVDLKDHWAKHGT 323
                       ******************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012265.3E-1221325IPR010409GAGA-binding transcriptional activator
PfamPF062175.4E-885323IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MQQQPSMKQI MGFMAERDAA IQERNLAISE KKTALAERDM AILQRDSAIA ERNNAIMERD  60
NAIATLQYRE NAINSSNNNM SPCPPGCQIP RGVKHMHHPQ QHQQQQQQHI HHHHHQSHMA  120
ESPYNNNNNS SNNNNNTRDN MQMSDTVPIS PVAPEPTKTR RAKRAKEAKP AATAAPRKAS  180
KNSKRVKREE DNNLNDLNNL NKAVFGKSHD MELGGPKLDW KDQDLGLNQV AFDESTMPVP  240
VCSCTGFLRP CYKWGNGGWQ SSCCTTNLSM YPLPAVPNKR HARVGGRKMS GSAFNKLISR  300
LAAEGHDLSN PVDLKDHWAK HGTIATSLSN RKKKKKIHHL MLMQDKK*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00540DAPTransfer from AT5G42520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083484.11e-158PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083485.11e-158PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083486.11e-158PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083487.11e-158PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083488.11e-158PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083489.11e-158PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083490.11e-158PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083491.11e-158PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083492.11e-158PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083493.11e-158PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083494.11e-158PREDICTED: protein BASIC PENTACYSTEINE6
SwissprotQ8L9991e-128BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLA0A022R8S90.0A0A022R8S9_ERYGU; Uncharacterized protein (Fragment)
STRINGGLYMA04G02860.11e-144(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-109basic pentacysteine 6